#HOT PRODUCT

[AlexoTech 한국공식대리점] Amyloid-Beta 1-40 Wild type (1.0 mg) Human, Recombinant

등록일2025. 11. 25
조회수117
링크 복사하기
[AlexoTech 한국공식대리점] Amyloid-Beta 1-40 Wild type (1.0 mg) Human, Recombinant

[AlexoTech 한국공식대리점] Amyloid-Beta 1-40 Wild type (1.0 mg) Human, Recombinant


어스바이오는 AlexoTech 한국 공식 대리점으로서 모든 제품을 전문적으로 취급 및 공급하고 있습니다.
AlexoTech의 Amyloid-Beta 제품을 소개드립니다.
 

[Amyloid-Beta 1-40 Wild type (1.0 mg) Human, Recombinant]


Amyloid-Beta 1-40 Wild type (1.0 mg) Human, Recombinant
 

Product Description:

  • Article no.: AB-100-10
  • Description: Recombinant Amyloid-Beta-peptide 1-40
  • Amount: 1 mg
  • Format: Lyophilized
  • Molecular Weight: 4330 Da
  • Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
  • Purity: 95% by Chromatography and SDS-PAGE
  • Counter Ion: Ammonium Acetate
  • Storage: Store at -20°C upon arrival.
  • Source: Protein expressed in Escherichia coli.


Solubility:

Alexotech has developed a proprietary method for preparing the amyloid β-peptide with superior solubility. It is, however, crucial to follow our recommended solubilization procedure. To effectively dissolve the amyloid β-peptide, the pH should be briefly raised to between 11 and 12. This can be achieved by adding 20 mM NaOH. At higher peptide concentrations, a greater NaOH concentration may be required due to the peptide’s intrinsic buffering capacity. The pH should therefore always be monitored and adjusted as necessary. After solubilization, the pH can be brought to the desired level using the buffer of choice.


Product Citations:

Lindberg, D. J., Wranne, M. S., Gilbert Gatty, M., Westerlund, F., & Esbjörner, E. K. (2015). Steady-state and time-resolved Thioflavin-T fluorescence can report on morphological differences in amyloid fibrils formed by Aβ(1-40) and Aβ(1-42). Biochemical and Biophysical Research Communications, 458(2), 418–423. https://doi.org/10.1016/j.bbrc.2015.01.132 

Horowitz, S., Koepnick, B., Martin, R., Tymieniecki, A., Winburn, A. A., Cooper, S., … Bardwell, J. C. (2016). Determining crystal structures through crowdsourcing and coursework. Nature communications, 7, 12549. doi:10.1038/ncomms12549

Luo, J., Wärmländer, S. K., Gräslund, A., & Abrahams, J. P. (2014). Non-chaperone proteins can inhibit aggregation and cytotoxicity of Alzheimer amyloid β peptide. The Journal of biological chemistry, 289(40), 27766–27775. doi:10.1074/jbc.M114.574947

Lu, J.-X., Qiang, W., Yau, W.-M., Schwieters, C. D., Meredith, S. C., & Tycko, R. (2013). Molecular Structure of β-Amyloid Fibrils in Alzheimer’s Disease Brain Tissue. Cell, 154(6), 1257–1268. https://doi.org/10.1016/j.cell.2013.08.035

Schultz, N., Brännström, K., Byman, E., Moussaud, S., Nielsen, H. M., … Olofsson, A. (2018). Amyloid-beta 1-40 is associated with alterations in NG2+ pericyte population ex vivo and in vitro. Aging Cell, 17(3), e12728. https://doi.org/10.1111/acel.12728
 


어스바이오(USBIO)는 AlexoTech 한국 공식 대리점입니다.
해당 제품에 대한 문의나 AlexoTech 제품의 견적 또는 문의사항이 있으시면 아래로 연락주시기 바랍니다.
Tel : 02-862-2816 / email : bio@usbio.co.kr
관련 포스트